← Home

@amqp-contract/worker

npm Repository Homepage

Worker utilities for consuming messages using amqp-contract

47
Versions
MIT
License
No
Install Scripts
Verified
Provenance

Supply chain provenance

Status for the latest visible version.

SLSA provenance attestation npm registry signatures No source commit

Maintainers

benoittravers

Keywords

amqpconsumercontractmessage-brokermessage-queuemessagingnodejsrabbitmqschematype-safetypescriptvalidationworker

Accepted risks

Findings the reviewer chose to accept rather than block on.

SourceRuleReasonAccepted byWhen
dependencies unvetted-dep:unthrown AI (dependencies): unthrown is a deliberate replacement for neverthrow; same error-handling domain, low surface area, stable for this package. ai
source-diff source-size-tripled AI (source-diff): Size growth reflects bundled CJS+ESM+type declarations for a growing monorepo package, not injected payload. ai
publish-pattern new-deps-added AI (publish-pattern): New deps are same-monorepo sibling and a well-known schema spec; consistent with package purpose. ai
provenance publisher-changed AI (provenance): Publisher is GitHub Actions with SLSA provenance; CI/CD automation replacing manual publish is expected for this repo. ai
provenance slsa-provenance AI (provenance): SLSA provenance attestation confirms CI/CD build integrity; stable positive signal for this package. ai
dependencies unvetted-dep:@amqp-contract/core AI (dependencies): Same monorepo/publisher (@amqp-contract org); sibling package published in lockstep at matching version 0.25.0. ai

Versions (showing 47 of 47)

Version Deps Published
2.4.0 3 / 17
2.3.0 3 / 15
2.2.0 4 / 14
2.1.0 4 / 14
2.0.0 4 / 14
1.0.0 4 / 14
0.25.0 4 / 14
0.24.0 4 / 14
0.23.1 4 / 14
0.23.0 4 / 14
0.22.0 4 / 14
0.21.0 4 / 14
0.20.0 4 / 14
0.19.0 4 / 14
0.18.0 4 / 14
0.17.0 4 / 14
0.16.0 4 / 14
0.15.0 4 / 14
0.14.0 4 / 14
0.13.0 4 / 14
0.12.0 4 / 14
0.11.0 4 / 14
0.10.0 4 / 14
0.9.0 4 / 14
0.8.0 4 / 14
0.7.0 4 / 14
0.6.0 4 / 14
0.5.0 4 / 14
0.4.0 4 / 15
0.3.5 4 / 15
0.3.4 4 / 15
0.3.3 4 / 15
0.3.2 4 / 15
0.3.1 4 / 15
0.3.0 4 / 15
0.2.1 4 / 15
0.2.0 3 / 11
0.1.4 2 / 11
0.1.3 2 / 11
0.1.2 2 / 11
0.1.1 2 / 11
0.1.0 2 / 11
0.0.6 1 / 11
0.0.5 1 / 11
0.0.4 1 / 11
0.0.2 1 / 9
0.0.1 1 / 8

v2.4.0

1 finding
INFO Has SLSA provenance attestation provenance

Published via CI/CD with Sigstore attestation (predicate: https://slsa.dev/provenance/v1). This is the strongest supply chain integrity signal.

v2.3.0

1 finding
INFO Has SLSA provenance attestation provenance

Published via CI/CD with Sigstore attestation (predicate: https://slsa.dev/provenance/v1). This is the strongest supply chain integrity signal.

v2.2.0

1 finding
INFO Has SLSA provenance attestation provenance

Published via CI/CD with Sigstore attestation (predicate: https://slsa.dev/provenance/v1). This is the strongest supply chain integrity signal.

v2.1.0

1 finding
INFO Has SLSA provenance attestation provenance

Published via CI/CD with Sigstore attestation (predicate: https://slsa.dev/provenance/v1). This is the strongest supply chain integrity signal.

v2.0.0

1 finding
INFO Has SLSA provenance attestation provenance

Published via CI/CD with Sigstore attestation (predicate: https://slsa.dev/provenance/v1). This is the strongest supply chain integrity signal.

v0.24.0

1 finding
INFO Has SLSA provenance attestation provenance

Published via CI/CD with Sigstore attestation (predicate: https://slsa.dev/provenance/v1). This is the strongest supply chain integrity signal.

v0.23.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.22.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.21.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.20.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.19.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.18.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.17.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.16.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.15.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.14.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.13.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.12.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.10.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.9.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.8.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.6.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.5.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.4.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.3.5

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.3.4

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.3.3

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.3.2

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.3.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.2.1

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.2.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.