← Home

@contract-kit/server

npm Repository Homepage
10
Versions
—
License
No
Install Scripts
Missing
Provenance

Supply chain provenance

Status for the latest visible version.

No SLSA provenance npm registry signatures gitHead linked

Without SLSA provenance there is no cryptographic link between this tarball and the public source — the axios compromise (March 2026) relied on exactly this gap.

Maintainers

taylorbryant

Keywords

contractapitypescriptserverframework-agnostichttpstandard-schema

Accepted risks

Findings the reviewer chose to accept rather than block on.

SourceRuleReasonAccepted byWhen
phantom-deps phantom-dep:@contract-kit/domain AI (phantom-deps): Same-org monorepo sibling; declared as dep but may be transitively used rather than directly imported. ai
typosquat typosquat.levenshtein:semver AI (typosquat): Scoped monorepo package; name similarity to semver is coincidental, not impersonation. ai

Versions (showing 10 of 10)

Version Deps Published
1.0.0 5 / 5
0.1.10 4 / 5
0.1.9 4 / 5
0.1.8 4 / 5
0.1.7 4 / 5
0.1.6 4 / 5
0.1.5 4 / 5
0.1.4 4 / 5
0.1.2 6 / 5
0.1.1 6 / 5

v1.0.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.1.10

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.1.9

2 findings
HIGH typosquat.levenshtein: Possible typosquat of 'semver' typosquat

Package name '@contract-kit/server' is 1 edit(s) away from popular package 'semver'.

LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.1.8

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.1.7

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.1.6

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.1.5

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.1.4

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.1.2

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.1.1

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.