← Home

@oracle/oraclejet-selenium-driver

32
Versions
License
No
Install Scripts
Missing
Provenance

Supply chain provenance

Status for the latest visible version.

No SLSA provenance npm registry signatures No source commit

Without SLSA provenance there is no cryptographic link between this tarball and the public source, so a manually published version cannot be tied back to a reviewed commit.

Maintainers

mvandervlietdmvjspeppertechcjbjkrismohanmilanvlacilkentarokinebuchihenrickyaubenknjingwuvic-nikmargabittotalamateurhourkarl-anthony-ngdrebolledamanish2788antoniofrucilfpvillegasmurselvaaseovicrhpatrickmgriccellilfeigenddsharpemig8447gek1bradtuckettwankevincflemminglesiachabanspavlusievavadimtroali.syedmeghana-vadlapallyvasaclucas.braunlmujumdarprabhuagkillianlynchpratiktiwarimbaadiejsefahwlouie-orclsmadeghe-orcl

Accepted risks

Findings the reviewer chose to accept rather than block on.

SourceRuleReasonAccepted byWhen
email-domain unclaimed-email:telety.io AI (email-domain): Package is under @oracle scope with established publisher track record; email domain risk is low in this context. ai
bogus-package bogus-package AI (bogus-package): Internal Oracle tooling package; missing metadata is expected for scoped enterprise packages. ai
npm-metadata no-description AI (npm-metadata): Internal Oracle tooling package; missing description is consistent across the OracleJET package family. ai

Versions (showing 32 of 32)

Version Deps Published
20.1.3 1 / 16
20.1.2 1 / 16
20.1.1 1 / 16
20.0.6 1 / 16
20.0.5 1 / 16
20.0.4 1 / 16
20.0.3 1 / 16
20.0.2 1 / 16
20.0.1 1 / 16
20.0.0 1 / 16
19.0.8 1 / 16
19.0.7 1 / 16
19.0.6 1 / 16
19.0.5 1 / 16
19.0.4 1 / 16
19.0.3 1 / 16
19.0.2 1 / 16
19.0.1 1 / 16
18.1.10 1 / 10
18.1.9 1 / 10
18.1.8 1 / 10
18.1.7 1 / 10
18.1.6 1 / 10
18.0.15 1 / 10
18.0.14 1 / 10
18.0.13 1 / 10
18.0.12 1 / 10
18.0.11 1 / 10
18.0.10 1 / 10
17.1.9 1 / 4
17.1.8 1 / 4
17.0.11 1 / 4

v20.1.3

2 findings
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

INFO Publisher changed: smadeghe-orcl → meghana-vadlapally (on 2026-07-15, known maintainer) provenance

This version was published by a different npm account (meghana-vadlapally) than the most recent previously approved version (smadeghe-orcl) on 2026-07-15, but meghana-vadlapally is listed as a maintainer on prior approved versions (matched on name). This looks like a manual publish by a known maintainer rather than a publisher change. Recorded as INFO for audit trail.

v20.0.6

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v18.1.10

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v18.0.15

2 findings
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

INFO Publisher changed: meghana-vadlapally → smadeghe-orcl (on 2026-07-09, known maintainer) provenance

This version was published by a different npm account (smadeghe-orcl) than the most recent previously approved version (meghana-vadlapally) on 2026-07-09, but smadeghe-orcl is listed as a maintainer on prior approved versions (matched on name). This looks like a manual publish by a known maintainer rather than a publisher change. Recorded as INFO for audit trail.