← Home

@oracle/oraclejet-testing

33
Versions
License
No
Install Scripts
Missing
Provenance

Supply chain provenance

Status for the latest visible version.

No SLSA provenance npm registry signatures No source commit

Without SLSA provenance there is no cryptographic link between this tarball and the public source, so a manually published version cannot be tied back to a reviewed commit.

Maintainers

mvandervlietdmvjspeppertechcjbjkrismohanmilanvlacilkentarokinebuchihenrickyaubenknjingwuvic-nikmargabittotalamateurhourkarl-anthony-ngdrebolledamanish2788antoniofrucilfpvillegasmurselvaaseovicrhpatrickmgriccellilfeigenddsharpemig8447gek1bradtuckettwankevincflemminglesiachabanspavlusievavadimtroali.syedmeghana-vadlapallyvasaclucas.braunlmujumdarprabhuagkillianlynchpratiktiwarimbaadiejsefahwlouie-orclsmadeghe-orcl

Accepted risks

Findings the reviewer chose to accept rather than block on.

SourceRuleReasonAccepted byWhen
provenance publisher-changed AI (provenance): Oracle-org internal maintainer rotation; new publisher has clean track record within the same org. ai
email-domain unclaimed-email:telety.io AI (email-domain): Established Oracle package; email domain issue is a metadata concern but no other malicious signals present. ai
bogus-package bogus-package AI (bogus-package): Oracle internal package; sparse metadata is consistent across the oraclejet monorepo, not a spam/malware indicator. ai
npm-metadata no-description AI (npm-metadata): Established Oracle monorepo package; missing description is a metadata style choice, not a risk signal. ai
provenance no-provenance AI (provenance): No provenance is common for enterprise/internal packages; not a risk signal here. ai

Versions (showing 33 of 33)

Version Deps Published
20.1.3 0 / 14
20.1.2 0 / 14
20.1.1 0 / 14
20.1.0 0 / 14
20.0.6 0 / 14
20.0.5 0 / 14
20.0.4 0 / 14
20.0.3 0 / 14
20.0.2 0 / 14
20.0.1 0 / 14
20.0.0 0 / 14
19.0.8 0 / 14
19.0.7 0 / 14
19.0.6 0 / 14
19.0.5 0 / 14
19.0.4 0 / 14
19.0.3 0 / 14
19.0.2 0 / 14
19.0.1 0 / 14
18.1.10 0 / 4
18.1.9 0 / 4
18.1.8 0 / 4
18.1.7 0 / 4
18.1.6 0 / 4
18.0.15 0 / 4
18.0.14 0 / 4
18.0.13 0 / 4
18.0.12 0 / 4
18.0.11 0 / 4
18.0.10 0 / 4
17.1.9 0 / 4
17.1.8 0 / 4
17.0.11 0 / 4

v20.1.3

2 findings
INFO No provenance attestation provenance

[Accepted risk] Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

INFO Publisher changed: smadeghe-orcl → meghana-vadlapally (on 2026-07-15, known maintainer) provenance

This version was published by a different npm account (meghana-vadlapally) than the most recent previously approved version (smadeghe-orcl) on 2026-07-15, but meghana-vadlapally is listed as a maintainer on prior approved versions (matched on name). This looks like a manual publish by a known maintainer rather than a publisher change. Recorded as INFO for audit trail.

v20.0.6

1 finding
INFO No provenance attestation provenance

[Accepted risk] Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v18.1.10

1 finding
INFO No provenance attestation provenance

[Accepted risk] Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v18.0.15

2 findings
INFO No provenance attestation provenance

[Accepted risk] Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

INFO Publisher changed: meghana-vadlapally → smadeghe-orcl (on 2026-07-09, known maintainer) provenance

This version was published by a different npm account (smadeghe-orcl) than the most recent previously approved version (meghana-vadlapally) on 2026-07-09, but smadeghe-orcl is listed as a maintainer on prior approved versions (matched on name). This looks like a manual publish by a known maintainer rather than a publisher change. Recorded as INFO for audit trail.