← Home

@redocly/reef

Reef is Redocly's API management platform that organizes, aids discovery, and monitors APIs throughout their lifecycle.

32
Versions
SEE LICENSE IN LICENSE
License
No
Install Scripts
Missing
Provenance

Supply chain provenance

Status for the latest visible version.

No SLSA provenance npm registry signatures No source commit

Without SLSA provenance there is no cryptographic link between this tarball and the public source, so a manually published version cannot be tied back to a reviewed commit.

Maintainers

romanhotsiyalawaradamaltmanmarshevskyyvolodymyr-rutskyislavikbezkorovainyi

Accepted risks

Findings the reviewer chose to accept rather than block on.

SourceRuleReasonAccepted byWhen
phantom-deps phantom-dep:buffer AI (phantom-deps): Monorepo build likely resolves deps via dist bundling, not static import. ai
phantom-deps phantom-dep:dotenv AI (phantom-deps): Same pattern as other phantom deps in this build. ai
bogus-package bogus-package AI (bogus-package): Internal Redocly package, established publisher; missing metadata is cosmetic. ai
source-diff obfuscated-file:dist/constants/l10n/langs/ar.js AI (source-diff): i18n JSON data bundled into single line, not code obfuscation. ai
phantom-deps phantom-dep:anser AI (phantom-deps): Large monorepo package; config-referenced deps are expected false positives. ai
source-diff obfuscated-file:dist/server/plugins/catalog-entities/extensions/extractors/api-description/arazzo-entities-extractor.js AI (source-diff): esbuild-minified build output per package's own build:minify script. ai
dependencies unvetted-dep:@redocly/mcp-typescript-sdk AI (dependencies): Same-org first-party package. ai
phantom-deps phantom-dep:ulid AI (phantom-deps): Large monorepo package.json; config-referenced not unused. ai
source-diff obfuscated-file:dist/server/plugins/mcp/docs-mcp/tools/graphql/utils.js AI (source-diff): Minified build output from documented esbuild-minify step, not true obfuscation. ai
source-diff obfuscated-file:dist/server/plugins/catalog-entities/database/remote-publish-lock-service.js AI (source-diff): Minified by esbuild-minify-dir build step; content is legitimate domain logic. ai
source-diff obfuscated-file:dist/server/plugins/catalog-entities/database/catalog-entities-publisher.js AI (source-diff): Minified by esbuild-minify-dir build step; content is legitimate domain logic. ai
source-diff obfuscated-file:dist/server/plugins/catalog-entities/database/repositories/entities/entities-read-repository.js AI (source-diff): Minified by esbuild-minify-dir build step; content is legitimate domain logic. ai
source-diff obfuscated-file:dist/server/plugins/catalog-entities/database/repositories/entities/entities-write-repository.js AI (source-diff): Minified by esbuild-minify-dir build step; content is legitimate domain logic. ai
source-diff obfuscated-file:dist/server/web-server/routes/mcp-routes/mcp-oauth.js AI (source-diff): Minified by esbuild-minify-dir build step; content is OAuth flow logic, no exfiltration. ai
source-diff obfuscated-file:dist/server/plugins/catalog-entities/database/repositories/relations/relations-read-repository.js AI (source-diff): Minified by esbuild-minify-dir build step; content is legitimate domain logic. ai
phantom-deps phantom-dep:react-dom AI (phantom-deps): Listed as peerDependency; phantom-dep heuristic false positive for this package. ai
phantom-deps phantom-dep:@babel/core AI (phantom-deps): Framework-scoped, loaded by convention per analyzer note. ai
phantom-deps phantom-dep:@opentelemetry/context-zone AI (phantom-deps): Framework-loaded telemetry dep; stable false positive for this package. ai
phantom-deps phantom-dep:@redocly/portal-plugin-mock-server AI (phantom-deps): Same org scope; loaded by convention in monorepo, not a direct import. ai

Versions (showing 32 of 32)

Version Deps Published
0.135.0 87 / 0
0.134.0 85 / 0
0.132.1 84 / 0
0.131.3 85 / 0
0.131.0 85 / 0
0.129.0 87 / 0
0.128.1 86 / 0
0.127.0 86 / 0
0.123.0 83 / 0
0.122.3 82 / 0
0.122.2 82 / 0
0.122.1 82 / 0
0.122.0 82 / 0
0.121.1 80 / 0
0.121.0 80 / 0
0.99.2 60 / 0
0.98.2 66 / 0
0.98.1 66 / 0
0.98.0 66 / 0
0.97.4 66 / 0
0.97.3 66 / 0
0.97.0 66 / 0
0.94.2 66 / 0
0.93.2 66 / 0
0.92.4 66 / 0
0.91.2 66 / 0
0.91.1 66 / 0
0.89.5 66 / 0
0.89.3 66 / 0
0.89.0 66 / 0
0.86.4 66 / 0
0.86.0 66 / 0

v0.135.0

2 findings
HIGH New obfuscated file: dist/server/plugins/mcp/docs-mcp/tools/graphql/utils.js source-diff

Newly added source file contains lines over 3000 chars, suggesting minified or obfuscated code. New obfuscated files are a strong attack indicator.

LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.131.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.127.0

8 findings
HIGH New obfuscated file: dist/constants/l10n/langs/ar.js source-diff

Newly added source file contains lines over 3000 chars, suggesting minified or obfuscated code. New obfuscated files are a strong attack indicator.

HIGH New obfuscated file: dist/server/plugins/catalog-entities/extensions/extractors/api-description/arazzo-entities-extractor.js source-diff

Newly added source file contains lines over 3000 chars, suggesting minified or obfuscated code. New obfuscated files are a strong attack indicator.

HIGH New obfuscated file: dist/server/plugins/catalog-entities/extensions/extractors/api-description/asyncapi-entities-extractor.js source-diff

Newly added source file contains lines over 3000 chars, suggesting minified or obfuscated code. New obfuscated files are a strong attack indicator.

HIGH New obfuscated file: dist/server/plugins/catalog-entities/database/repositories/local/catalog-entities-local-read-repository.js source-diff

Newly added source file contains lines over 3000 chars, suggesting minified or obfuscated code. New obfuscated files are a strong attack indicator.

HIGH New obfuscated file: dist/server/plugins/catalog-entities/database/repositories/remote/catalog-entities-remote-repository.js source-diff

Newly added source file contains lines over 3000 chars, suggesting minified or obfuscated code. New obfuscated files are a strong attack indicator.

HIGH New obfuscated file: dist/server/plugins/catalog-entities/database/catalog-entities-service.js source-diff

Newly added source file contains lines over 3000 chars, suggesting minified or obfuscated code. New obfuscated files are a strong attack indicator.

HIGH New obfuscated file: dist/server/constants/plugins/catalog-entities.js source-diff

Newly added source file contains lines over 3000 chars, suggesting minified or obfuscated code. New obfuscated files are a strong attack indicator.

LOW No provenance attestation provenance

Package was published without Sigstore provenance. Consider requesting the maintainer enable provenance via CI/CD.

v0.99.2

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.98.2

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.98.1

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.98.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.97.4

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.97.3

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.97.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.94.2

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.93.2

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.92.4

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.91.2

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.91.1

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.89.5

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.89.3

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.89.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.86.4

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.

v0.86.0

1 finding
LOW No provenance attestation provenance

Package was published without Sigstore provenance. Only ~12% of npm packages have provenance, so this is common but not ideal.